PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g23625.1.p
Common NameBRADI_4g23625
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 765aa    MW: 88039.2 Da    PI: 9.8839
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g23625.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR122.63.5e-0713544991
              FAR1 49 ekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                      +k+ +++  + t+C+ k++v+++ ++kw+vt++e + nH+l+p
  Bradi4g23625.1.p 13 KKAINKNHIEITDCQVKMVVTLK-ENKWVVTSFEMQDNHHLSP 54
                      4677899999*************.9***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.3E-51354IPR004330FAR1 DNA binding domain
PfamPF105513.9E-32174268IPR018289MULE transposase domain
SMARTSM005750.0023469496IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
MQKAGLTSAV QGKKAINKNH IEITDCQVKM VVTLKENKWV VTSFEMQDNH HLSPPGEAKY  60
LRSHKHMTEE EKLLIRTLHS VKLPSRKIMA VLAGMRGGIS AMPYTKKDVS NYRTSIRKES  120
NQNDMMMVID YFRKRQMQDP RFYYAFKVDE EDKVQNIFWS DGNCRRFYGL YGDCISFDTT  180
YKTNMYNLPF APFVGITGHA HNCLFACAIL QNETIETFTW LFEEFLLCMA GKKPLTIITD  240
QDVAMKQAIP AVFHGTKHRN CLFHIKKKAE EKAARCFATK PTLHIEFNDI INRSQTEEEF  300
ETLWPTMIQK YKVEKVKYFQ HMFEIRKSFV PVYFKKDFFP FIHSTARSEG TNAIFKDNVG  360
STYSIISFLG EYQRISENIM EKEKEQDSVT RTTKPTMWVG SELELQAARM YNRTILYRFQ  420
AQLKMTQKVH VEEIEKDVRY EVRKSSMLAE LDFRERKFLV LVDWANEDIS YICARFLKDG  480
ILCCHALKVL LHLNVSVLPQ KYYIERWRPK QSEDTRDVQN NVPMVLTAEN SHFRYNILTK  540
MLTDLASDAS TYKETYQYLA SKTSKMRTKV ADIRKQVEAK NPEKQTPVGS TEHNNTSNNC  600
APETIYKQSD VAKSKGRPKL SGRQKTLVEE ILTKQQITCS HCGDHDHNIK TCKKLHVDKE  660
TLCMKNNGRK NKEGATAVSK PAKKQRTTDE AAHVASAVPR DAKGGQNVSK PTKKKTNTEG  720
QASGIVSSPN PSREGQSQRI RKPTQKALES MLVLTPTRKH GKQG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757844.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0Q3ISG80.0A0A0Q3ISG8_BRADI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.14e-98FAR1-related sequence 5